PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi012744
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family GRAS
Protein Properties Length: 195aa    MW: 21923.7 Da    PI: 5.6137
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S55421046PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS217.76.1e-673179193373
       GRAS 193 eLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                +L+vk++E++aVn++lqlh++l ++++       +L l++s++P vvvvveqea+hn++ F  rfl+al+yysa+fds++a+lp++s +r k+E++ ++r
  Psi012744   3 MLHVKEKETVAVNCMLQLHKTLYDNGAALR---GILGLIQSTKPAVVVVVEQEANHNDQIFEGRFLQALQYYSAIFDSIDANLPSDSPARLKMEQF-FAR 98 
                89********************88888777...9**************************************************************.*** PP

       GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                ei+n++aceg er+erhe++e+W++++ee GF++vpl+e++ +qa+ ll +++ + yrv+ e+g l+lgW d+pL+++SaW
  Psi012744  99 EIRNIIACEGPERIERHEKFEHWKQMMEEGGFTAVPLGEREHCQARILLDMFPCKNYRVKLEDGRLTLGWLDQPLYTASAW 179
                *****************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098526.0291160IPR005202Transcription factor GRAS
PfamPF035142.1E-643179IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
XGMLHVKEKE TVAVNCMLQL HKTLYDNGAA LRGILGLIQS TKPAVVVVVE QEANHNDQIF  60
EGRFLQALQY YSAIFDSIDA NLPSDSPARL KMEQFFAREI RNIIACEGPE RIERHEKFEH  120
WKQMMEEGGF TAVPLGEREH CQARILLDMF PCKNYRVKLE DGRLTLGWLD QPLYTASAWA  180
PQEGGNGGAS TSSPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-296179197374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015896272.17e-76PREDICTED: scarecrow-like protein 28
SwissprotQ9CAN32e-57SCL28_ARATH; Scarecrow-like protein 28
TrEMBLD5ABF01e-145D5ABF0_PICSI; Putative uncharacterized protein
STRINGVIT_02s0025g04000.t014e-73(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-58GRAS family protein